Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8)

In Stock
Code CSB-EP005168HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Carcinoembryonic antigen CGM6; Carcinoembryonic antigen gene family member 6; Carcinoembryonic antigen related cell adhesion molecule 8; Carcinoembryonic antigen-related cell adhesion molecule 8; CD 66b; CD 67; CD66b; CD66b antigen; CD67; CD67 antigen; CEACAM 8; CEACAM8; CEAM8_HUMAN; CGM 6; CGM6; NCA 95; NCA95; Non-specific cross-reacting antigen NCA-95; Nonspecific cross reacting antigen NCA 95; Nonspecific cross reacting antigen NCA95
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
35-320aa
Target Protein Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
47.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Human CEACAM8 protein is an exceptional resource for research in immunology, focusing on the Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8). Known also as CD67 antigen, Carcinoembryonic antigen CGM6, Non-specific cross-reacting antigen NCA-95, and CD66b, this protein plays a crucial role in cellular adhesion, immune cell activation, and signaling pathways. Produced in E. coli, the product covers the full length of the mature CEACAM8 protein (35-320aa) and features an N-terminal 6xHis-SUMO tag for efficient purification and detection purposes.

With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human CEACAM8 protein is supplied as a lyophilized powder to ensure consistency and dependability in your immunology research. This product facilitates accurate and reliable results in a variety of research areas, such as inflammation, immune response, and cancer biology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

You wouldn't happen to have lots that were lyophilized from PBS or any other non-amine buffer would you? The Tris in the buffer makes it difficult to do amine-based labeling like biotinylation without further clean-up.

A:

We will try to dialysis and exchange the stock protein into PBS buffer first, lead time is 3-7 business days if we succeed. Otherwise, we will prepare a new lot with PBS buffer, lead time is 13-23 business days.

Target Background

Function
Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.
Gene References into Functions
  1. Increased CD66b positive tumor-infiltrating neutrophils (CD66b + TINs) was significantly associated with presence of metastasis, S stage, and nonseminomatous germ cell tumor diagnosis. PMID: 27863478
  2. Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID: 26483485
  3. Granulocytes from type 2 diabetes patients display higher granulocyte cell surface expression of CD66b compared with values of healthy controls. PMID: 23686079
  4. The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID: 21470677
  5. All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes. PMID: 17909799
  6. CD66b molecules are involved in regulating adhesion and activation of eosinophils, possibly through their localization in lipid rafts and interaction with other cell surface molecules, such as CD11b. PMID: 18056392

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Cell surface.
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
Database Links

HGNC: 1820

OMIM: 615747

KEGG: hsa:1088

STRING: 9606.ENSP00000244336

UniGene: Hs.41

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*